PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG033275.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Dof
Protein Properties Length: 320aa    MW: 35176.4 Da    PI: 7.869
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG033275.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.66.5e-393190261
       zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                 +++alkcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk k+s
  CCG033275.1 31 NHQALKCPRCDSLNTKFCYYNNYNLSQPRHFCKSCRRYWTKGGVLRNVPVGGGCRKTKRS 90
                 57899****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-272989IPR003851Zinc finger, Dof-type
PfamPF027012.8E-333389IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.6183589IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103773IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MQEIHSIGGG GRLFSGGGGG DRRLRPHHHQ NHQALKCPRC DSLNTKFCYY NNYNLSQPRH  60
FCKSCRRYWT KGGVLRNVPV GGGCRKTKRS KLKQNTPSTT SDTITTSSTR PQELQEKHQR  120
RDHVSSNSHS SSESSSLTAT NNTNANTAVE AVSALSVNSV SNNLLNGIVE SKSFPRGDMN  180
PSFEPALLEQ GSDCGIFSEI GSFTSLITST NDLSFGFSNT TNQQQQQGLE HHVQNNQNQQ  240
QWQNQHQEMT GGLIDQTIHA ELSALPSSSR STENTGGGFG ALDWQLGSGD QAGGFFYLPN  300
TVDQAYWSQS QWNDMTAYLP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1917GGRLFSGGG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00570DAPTransfer from AT5G60850Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1480340.0EF148034.1 Populus trichocarpa clone WS0126_P16 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011011961.10.0PREDICTED: dof zinc finger protein DOF5.4-like
TrEMBLA9PI210.0A9PI21_POPTR; Putative uncharacterized protein
STRINGPOPTR_0015s03520.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59983050
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.11e-38OBF binding protein 4